Structure of PDB 5b1z Chain A Binding Site BS01

Receptor Information
>5b1z Chain A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFS
DLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVD
KEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
Ligand information
>5b1z Chain C (length=16) Species: 10407 (Hepatitis B virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KDWEELGEEIRLKVFV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5b1z Crystal structure of Bcl-xL in complex with HBx-BH3 motif
Resolution2.15 Å
Binding residue
(original residue number in PDB)		E40 F41 Y45 F49 L52 V70 E73 R76 D77 R83 L138 Y139
Binding residue
(residue number reindexed from 1)		E40 F41 Y45 F49 L52 V70 E73 R76 D77 R83 L138 Y139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5b1z, PDBe:5b1z, PDBj:5b1z
PDBsum5b1z
PubMed
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]