Structure of PDB 5azf Chain A Binding Site BS01

Receptor Information
>5azf Chain A (length=119) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKK
KYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQD
HHEEDLFLYIAYSDESVYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5azf Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		I21 R28 P30 K46 K48 Y49 L50 V51 P52 F60 L63 R67 F104
Binding residue
(residue number reindexed from 1)		I24 R31 P33 K49 K51 Y52 L53 V54 P55 F63 L66 R70 F107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0001778 plasma membrane repair
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0008340 determination of adult lifespan
GO:0009408 response to heat
GO:0012501 programmed cell death
GO:0016236 macroautophagy
GO:0040024 dauer larval development
GO:0050830 defense response to Gram-positive bacterium
GO:0070266 necroptotic process
GO:0097237 cellular response to toxic substance
GO:0097352 autophagosome maturation
GO:0098792 xenophagy
GO:2000786 positive regulation of autophagosome assembly
Cellular Component
GO:0000407 phagophore assembly site
GO:0000421 autophagosome membrane
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005886 plasma membrane
GO:0030425 dendrite
GO:0030670 phagocytic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043202 lysosomal lumen
GO:0043204 perikaryon

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5azf, PDBe:5azf, PDBj:5azf
PDBsum5azf
PubMed26687600
UniProtQ09490|LGG1_CAEEL Protein lgg-1 (Gene Name=lgg-1)

[Back to BioLiP]