Structure of PDB 5avl Chain A Binding Site BS01

Receptor Information
>5avl Chain A (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQLSPEQLGMIEKLVAAQQVTPWREARQQRFAHFTELAIVSVQEIVDFAK
QLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNR
EDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQ
DQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSE
QVFALRLQDKKLPPLLSEIWDVHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5avl Discovery and structure-guided optimization of tert-butyl 6-(phenoxymethyl)-3-(trifluoromethyl)benzoates as liver X receptor agonists
Resolution2.8 Å
Binding residue
(original residue number in PDB)		V269 K273 R283 E284 I287 A288 K291 P437 L438 E441
Binding residue
(residue number reindexed from 1)		V46 K50 R60 E61 I64 A65 K68 P214 L215 E218
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5avl, PDBe:5avl, PDBj:5avl
PDBsum5avl
PubMed26238323
UniProtQ13133|NR1H3_HUMAN Oxysterols receptor LXR-alpha (Gene Name=NR1H3)

[Back to BioLiP]