Structure of PDB 5aul Chain A Binding Site BS01

Receptor Information
>5aul Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSV
VVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLN
VTLAYPVYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aul Crystal Structures and Thermodynamic Analysis Reveal Distinct Mechanisms of CD28 Phosphopeptide Binding to the Src Homology 2 (SH2) Domains of Three Adaptor Proteins
Resolution1.1 Å
Binding residue
(original residue number in PDB)
R631 R649 S651 S652 K653 H669 C670 F681 A682 H706 N707 L710
Binding residue
(residue number reindexed from 1)
R20 R38 S40 S41 K42 H58 C59 F70 A71 H95 N96 L99
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5aul, PDBe:5aul, PDBj:5aul
PDBsum5aul
PubMed27927989
UniProtP27986|P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=PIK3R1)

[Back to BioLiP]