Structure of PDB 5agx Chain A Binding Site BS01

Receptor Information
>5agx Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GYDNREIVMKYIHYKLSQRGYEWDASEVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP
Ligand information
>5agx Chain D (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IKIAQPLRKIGDKFNKYYARR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5agx Alpha Beta Peptide Foldamers Targeting Intracellular Protein-Protein Interactions with Activity on Living Cells
Resolution2.24 Å
Binding residue
(original residue number in PDB)		D103 F104 Y108 F112 T132 V133 E136 L137 N143 G145 R146 Y202
Binding residue
(residue number reindexed from 1)		D39 F40 Y44 F48 T68 V69 E72 L73 N79 G81 R82 Y138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5agx, PDBe:5agx, PDBj:5agx
PDBsum5agx
PubMed26317395
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2);
Q07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]