Structure of PDB 5afg Chain A Binding Site BS01

Receptor Information
>5afg Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIV
YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5afg Double Strain-Promoted Macrocyclization for the Rapid Selection of Cell-Active Stapled Peptides.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K51 L54 L57 G58 I61 M62 Y67 Q72 H73 V93 H96
Binding residue
(residue number reindexed from 1)		K26 L29 L32 G33 I36 M37 Y42 Q47 H48 V68 H71
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5afg, PDBe:5afg, PDBj:5afg
PDBsum5afg
PubMed26768531
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]