Structure of PDB 5af6 Chain A Binding Site BS01

Receptor Information
>5af6 Chain A (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQIFVKTLTGRTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL
EDGRTLSDYNIQKESTLHLVLRLRGG
Ligand information
>5af6 Chain H (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IKWACEYCTYENWPSAIKCTMCRAQRPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5af6 Assembly and Specific Recognition of K29- and K33-Linked Polyubiquitin.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		L8 R42 I44 G47 Q49 H68 V70 R72
Binding residue
(residue number reindexed from 1)		L8 R42 I44 G47 Q49 H68 V70 R72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5af6, PDBe:5af6, PDBj:5af6
PDBsum5af6
PubMed25752577
UniProtP0CG48|UBC_HUMAN Polyubiquitin-C (Gene Name=UBC)

[Back to BioLiP]