Structure of PDB 5aei Chain A Binding Site BS01

Receptor Information
>5aei Chain A (length=281) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQ
LLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ
ILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWA
LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGG
NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVK
EAGALEKLEQLQSHENEKIQKEAQEALEKLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aei Structure and Energetic Contributions of a Designed Modular Peptide-Binding Protein with Picomolar Affinity.
Resolution1.83 Å
Binding residue
(original residue number in PDB)		R33 Q37 S40 E72 W75 N79 S82 E114 W117 N121 S124 G125 W159 S162 N163 S166 G167 E198 W201 N205 S208 E240 W243
Binding residue
(residue number reindexed from 1)		R23 Q27 S30 E62 W65 N69 S72 E104 W107 N111 S114 G115 W149 S152 N153 S156 G157 E188 W191 N195 S198 E230 W233
External links