Structure of PDB 5ad0 Chain A Binding Site BS01

Receptor Information
>5ad0 Chain A (length=269) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIA
ANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDI
LEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAE
GLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRA
HGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGD
KYQCRVEHASLPQPGLYSW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ad0 Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
Resolution2.84 Å
Binding residue
(original residue number in PDB)
Y7 R9 D24 E62 I65 G68 I72 N76 W95 F120 T140 K143 W144 Y149 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)
Y6 R8 D23 E61 I64 G67 I71 N75 W94 F119 T139 K142 W143 Y148 Y155 W163 Y167
Enzymatic activity
Enzyme Commision number ?
External links