Structure of PDB 5a7a Chain A Binding Site BS01

Receptor Information
>5a7a Chain A (length=175) Species: 12327 (Barley stripe mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVSLTAKGGGHYIEDQWDTQVVEAGVFDDWWVHVEAWNKFLDNLRGINFS
VASSRSQVAEYLAALDRDLPADVDRRFAGARGQIGSPNYLPAPKFFRLDK
RTIAELTRLSRLTDQPHNNRDIELNRAKRTLRDVQPLKDSALHYQYVLID
LQSARLPVYTRKTFERELALEWIIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a7a Novel Inter-Subunit Contacts in Barley Stripe Mosaic Virus Revealed by Cryo-Electron Microscopy.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		K156 D157 S158 L160 H161 Y164
Binding residue
(residue number reindexed from 1)		K138 D139 S140 L142 H143 Y146
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
GO:0042802 identical protein binding
Cellular Component
GO:0019028 viral capsid
GO:0019029 helical viral capsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5a7a, PDBe:5a7a, PDBj:5a7a
PDBsum5a7a
PubMed26278173
UniProtP04866|CAPSD_BSMV Capsid protein

[Back to BioLiP]