Structure of PDB 5a79 Chain A Binding Site BS01

Receptor Information

>5a79 Chain A (length=177) Species: 12327 (Barley stripe mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NVSLTAKGGGHYIEDQWDTQVVEAGVFDDWWVHVEAWNKFLDNLRGINFS
VASSRSQVAEYLAALDRDLPADVDRRFAGARGQIGSPNYLPAPKFFRLDK
RTIAELTRLSRLTDQPHNNRDIELNRAKRLTLRDVQPLKDSALHYQYVLI
DLQSARLPVYTRKTFERELALEWIIPD

Ligand information

>5a79 Chain R (length=3) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaa

...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5a79 Novel Inter-Subunit Contacts in Barley Stripe Mosaic Virus Revealed by Cryo-Electron Microscopy.
Resolution	4.1 Å
Binding residue (original residue number in PDB)	Q117 K156 D157 L160 H161 Y164
Binding residue (residue number reindexed from 1)	Q115 K139 D140 L143 H144 Y147

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity
GO:0042802	identical protein binding

	Cellular Component
GO:0019028	viral capsid
GO:0019029	helical viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5a79, PDBe:5a79, PDBj:5a79
PDBsum	5a79
PubMed	26278173
UniProt	P04866\|CAPSD_BSMV Capsid protein

[Back to BioLiP]