Structure of PDB 5a72 Chain A Binding Site BS01

Receptor Information
>5a72 Chain A (length=157) Species: 3077 (Chlorella vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLNLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a72 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D23 C25 Q29 R43 F49 Q50 S51 R73 M77 T139 D140 G141 R144 T145
Binding residue
(residue number reindexed from 1)		D18 C20 Q24 R38 F44 Q45 S46 R68 M72 T134 D135 G136 R139 T140
Binding affinityPDBbind-CN: Kd=53.3nM
Enzymatic activity
Catalytic site (original residue number in PDB) A22 D23
Catalytic site (residue number reindexed from 1) A17 D18
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a72, PDBe:5a72, PDBj:5a72
PDBsum5a72
PubMed26363068
UniProtP56347|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]