Structure of PDB 5a53 Chain A Binding Site BS01

Receptor Information
>5a53 Chain A (length=65) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNV
QLLINQLLSLPMKTT
Ligand information
>5a53 Chain B (length=22) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVMTLLQLPDPTTDLPREKPLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a53 Chaperoning 5S RNA Assembly.
Resolution2.401 Å
Binding residue
(original residue number in PDB)		D22 L65 L68 P69 M70 K71 T72 T73
Binding residue
(residue number reindexed from 1)		D14 L57 L60 P61 M62 K63 T64 T65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a53, PDBe:5a53, PDBj:5a53
PDBsum5a53
PubMed26159998
UniProtQ08746|RRS1_YEAST Regulator of ribosome biosynthesis (Gene Name=RRS1)

[Back to BioLiP]