Structure of PDB 5a0x Chain A Binding Site BS01

Receptor Information
>5a0x Chain A (length=194) Species: 272563 (Clostridioides difficile 630) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSTTIQQNKDTLSQIVVFPTGNYDKNEANAMVNRLANIDGKYLNALKQNN
LKIKLLSGKLTDEKEYAYLKGVVPKGWEGTGKTWDDVPGLGGSTVALRIG
FSNKGKGHDAINLELHATAHAIDHIVLNDISKSAQFKQIFAKEGRSLGNV
NFLGVYPEEFFAESFAYYYLNQDTNSKLKSACPQTYSFLQNLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a0x Structural Basis of Proline-Proline Peptide Bond Specificity of the Metalloprotease Zmp1 Implicated in Motility of Clostridium Difficile.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		P100 K101 W103 W110 V113 L116 G117 G118 S119 H134 D135 A136 H142 H146 H150 N175 F178 E185
Binding residue
(residue number reindexed from 1)		P74 K75 W77 W84 V87 L90 G91 G92 S93 H108 D109 A110 H116 H120 H124 N149 F152 E159
Enzymatic activity
Enzyme Commision number 3.4.24.89: Pro-Pro endopeptidase.
Gene Ontology
Molecular Function
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a0x, PDBe:5a0x, PDBj:5a0x
PDBsum5a0x
PubMed26211609
UniProtQ183R7|PPEP1_CLOD6 Pro-Pro endopeptidase (Gene Name=zmp1)

[Back to BioLiP]