Structure of PDB 4zvr Chain A Binding Site BS01

Receptor Information
>4zvr Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFD
VIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVT
PIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zvr Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
R87 C186
Binding residue
(residue number reindexed from 1)
R30 C129
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 G145 C186
Catalytic site (residue number reindexed from 1) G28 V29 G88 C129
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4zvr, PDBe:4zvr, PDBj:4zvr
PDBsum4zvr
PubMed27032039
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]