Structure of PDB 4zuu Chain A Binding Site BS01

Receptor Information
>4zuu Chain A (length=274) Species: 9796 (Equus caballus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAP
WVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYG
CDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEA
GEAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVT
LRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLAEPVTLRW
Ligand information
>4zuu Chain C (length=9) Species: 11665 (Equine infectious anemia virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CTSEEMNAF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zuu Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
Resolution2.2 Å
Binding residue
(original residue number in PDB)
Y7 R62 E63 N66 G77 Y84 R97 Y99 T143 K146 R147 E152 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 R62 E63 N66 G77 Y84 R97 Y99 T143 K146 R147 E152 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links