Structure of PDB 4zut Chain A Binding Site BS01

Receptor Information
>4zut Chain A (length=274) Species: 9796 (Equus caballus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAP
WVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYG
CDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEA
GEAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVT
LRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLAEPVTLRW
Ligand information
>4zut Chain C (length=12) Species: 11665 (Equine infectious anemia virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSQKLTTGNCNW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zut Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
Resolution2.6 Å
Binding residue
(original residue number in PDB)		M5 Y7 E63 N66 E69 N73 G77 T80 Y84 R97 Y99 D116 T143 K146 R147 E152 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		M5 Y7 E63 N66 E69 N73 G77 T80 Y84 R97 Y99 D116 T143 K146 R147 E152 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links