Structure of PDB 4zpk Chain A Binding Site BS01

Receptor Information
>4zpk Chain A (length=268) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAV
SHMKSLSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQP
QSEWFGSTLYDQVHPDDVDKLREQLSTSRRSFICRMRCGTPHFVVVHCTG
YIKFCLVAIGRLQVTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNI
VEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWLWMRTSSFTF
QNPYSDEIEYIICTNTNV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zpk Structural integration in hypoxia-inducible factors.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R91 H94 E98 R99 R102 D127 K128
Binding residue
(residue number reindexed from 1)		R5 H8 E12 R13 R16 D41 K42
Binding affinityPDBbind-CN: Kd=45nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4zpk, PDBe:4zpk, PDBj:4zpk
PDBsum4zpk
PubMed26245371
UniProtP53762|ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator (Gene Name=Arnt)

[Back to BioLiP]