Structure of PDB 4zp3 Chain A Binding Site BS01

Receptor Information
>4zp3 Chain A (length=43) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR
Ligand information
>4zp3 Chain M (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DAELVRLSKRLVENAVLKAVQQYLEETQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zp3 AKAP18:PKA-RII alpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA.
Resolution2.63 Å
Binding residue
(original residue number in PDB)
S1 I3 I5 T10 L13 Q14 T17 V18 L21 R22
Binding residue
(residue number reindexed from 1)
S1 I3 I5 T10 L13 Q14 T17 V18 L21 R22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4zp3, PDBe:4zp3, PDBj:4zp3
PDBsum4zp3
PubMed27102985
UniProtP13861|KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit (Gene Name=PRKAR2A)

[Back to BioLiP]