Structure of PDB 4zny Chain A Binding Site BS01

Receptor Information
>4zny Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELM
NLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHV
DANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
>4zny Chain B (length=10) Species: 11908 (Human T-cell leukemia virus type I) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YVEPTAPQVL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zny Structure of the human TSG101-UEV Domain in complex with the PTAP motif of the p19 gag protein of the Human T-cell Leukemia type I virus
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D34 T58 Y63 Y68 N69 M95 V141 F142 S143
Binding residue
(residue number reindexed from 1)		D31 T55 Y60 Y65 N66 M92 V138 F139 S140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:4zny, PDBe:4zny, PDBj:4zny
PDBsum4zny
PubMed
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]