Structure of PDB 4zii Chain A Binding Site BS01

Receptor Information
>4zii Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGGPTSSEQIMKTGALLLQGFIQDRAGRELALDPVPQDASTKKLSESLKR
IGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFY
FASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYF
GT
Ligand information
>4zii Chain C (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SESQEDIIRNIARHLAQVGDSMDR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zii Crystal structure of Bax bound to the BH3 peptide of Bim identifies important contacts for interaction.
Resolution2.191 Å
Binding residue
(original residue number in PDB)		E75 L76 M79 V83 D84 V95 M99 N106 G108 R109
Binding residue
(residue number reindexed from 1)		E60 L61 M64 V68 D69 V80 M84 N91 G93 R94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4zii, PDBe:4zii, PDBj:4zii
PDBsum4zii
PubMed26158515
UniProtQ07812|BAX_HUMAN Apoptosis regulator BAX (Gene Name=BAX)

[Back to BioLiP]