Structure of PDB 4zif Chain A Binding Site BS01

Receptor Information
>4zif Chain A (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGPTSSEQIMKTGALLLQGFIQDRAGRDPVPQDASTKKLSESLKRIGDEL
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zif Crystal structure of Bax bound to the BH3 peptide of Bim identifies important contacts for interaction.
Resolution2.401 Å
Binding residue
(original residue number in PDB)		L70 N73 L76 M79 I80 D98 M99 D102 N106 G108 R109 F116
Binding residue
(residue number reindexed from 1)		L50 N53 L56 M59 I60 D78 M79 D82 N86 G88 R89 F96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4zif, PDBe:4zif, PDBj:4zif
PDBsum4zif
PubMed26158515
UniProtQ07812|BAX_HUMAN Apoptosis regulator BAX (Gene Name=BAX)

[Back to BioLiP]