Structure of PDB 4zie Chain A Binding Site BS01

Receptor Information
>4zie Chain A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGGPTSSEQIMKTGALLLQGFIQDRALDPVPQDASTKKLSESLKRIGDEL
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGS
Ligand information
>4zie Chain C (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPEIWIAQELRRIGDEFNAYYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zie Crystal structure of Bax bound to the BH3 peptide of Bim identifies important contacts for interaction.
Resolution1.797 Å
Binding residue
(original residue number in PDB)		I66 L70 E75 M79 I80 R94 V95 D98 M99 D102 N106 G108 R109
Binding residue
(residue number reindexed from 1)		I46 L50 E55 M59 I60 R74 V75 D78 M79 D82 N86 G88 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4zie, PDBe:4zie, PDBj:4zie
PDBsum4zie
PubMed26158515
UniProtQ07812|BAX_HUMAN Apoptosis regulator BAX (Gene Name=BAX)

[Back to BioLiP]