Structure of PDB 4zhb Chain A Binding Site BS01

Receptor Information
>4zhb Chain A (length=104) Species: 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IASAELRELMKAVSEGHYETVNTILDKDPELVNQYAPPTYDSPLARVLNK
KHIDYKMLDILVKHHVDFDYPINYHKETPIELACKNQDLQLFKYLVQHNA
PISE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zhb N-terminal structure of ankyrin repeat-containing protein legA11 from Legionella pneumophila
Resolution1.3 Å
Binding residue
(original residue number in PDB)
I11 A12 N43 Q44 Y45
Binding residue
(residue number reindexed from 1)
I1 A2 N33 Q34 Y35
Enzymatic activity
Enzyme Commision number ?
External links