Structure of PDB 4zeq Chain A Binding Site BS01

Receptor Information
>4zeq Chain A (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNL
KSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKK
LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK
Ligand information
>4zeq Chain B (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEDIIRNIARHLAQVGDSMDRSIPPG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zeq Crystal Structure of human BFL-1 in complex with tBid BH3 peptide
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V44 E47 V48 L52 C55 N58 V74 K77 E78 N85 W86 G87 R88 V90 T91 K146 K147 F148
Binding residue
(residue number reindexed from 1)		V42 E45 V46 L50 C53 N56 V72 K75 E76 N83 W84 G85 R86 V88 T89 K144 K145 F146
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4zeq, PDBe:4zeq, PDBj:4zeq
PDBsum4zeq
PubMed
UniProtQ16548|B2LA1_HUMAN Bcl-2-related protein A1 (Gene Name=BCL2A1)

[Back to BioLiP]