Structure of PDB 4zbn Chain A Binding Site BS01

Receptor Information
>4zbn Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNISVFKQYFFETKCRDSG
CRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zbn Non-helical DNA Triplex Forms a Unique Aptamer Scaffold for High Affinity Recognition of Nerve Growth Factor.
Resolution2.447 Å
Binding residue
(original residue number in PDB)		E11 F12 V18 S19 V20 W21 Y52 F54 R59 R69
Binding residue
(residue number reindexed from 1)		E1 F2 V8 S9 V10 W11 Y40 F42 R47 R52
Binding affinityPDBbind-CN: Kd=0.21nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding

View graph for
Molecular Function
External links
PDB RCSB:4zbn, PDBe:4zbn, PDBj:4zbn
PDBsum4zbn
PubMed26027732
UniProtP01138|NGF_HUMAN Beta-nerve growth factor (Gene Name=NGF)

[Back to BioLiP]