Structure of PDB 4z9v Chain A Binding Site BS01

Receptor Information
>4z9v Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRK
GQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z9v TCTP contains a BH3-like domain, which instead of inhibiting, activates Bcl-xL.
Resolution2.099 Å
Binding residue
(original residue number in PDB)
F97 R100 Y101 F105 E129 L130 D133 N136 G138 R139 A142 Y195
Binding residue
(residue number reindexed from 1)
F42 R45 Y46 F50 E74 L75 D78 N81 G83 R84 A87 Y140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4z9v, PDBe:4z9v, PDBj:4z9v
PDBsum4z9v
PubMed26813996
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]