Structure of PDB 4z8j Chain A Binding Site BS01

Receptor Information
>4z8j Chain A (length=96) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGA
ADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z8j Role of SNX27-retromer in PTHR trafficking
Resolution0.95 Å
Binding residue
(original residue number in PDB)
G50 Y51 F53 N54 V55 R56 G57 Q58 V59 S80 H112 V116
Binding residue
(residue number reindexed from 1)
G13 Y14 F16 N17 V18 R19 G20 Q21 V22 S43 H75 V79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4z8j, PDBe:4z8j, PDBj:4z8j
PDBsum4z8j
PubMed
UniProtQ8K4V4|SNX27_RAT Sorting nexin-27 (Gene Name=Snx27)

[Back to BioLiP]