Structure of PDB 4z7w Chain A Binding Site BS01

Receptor Information
>4z7w Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFR
RFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTL
GQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKIS
YLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Ligand information
>4z7w Chain J (length=15) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSGEGSFQPSQENPQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z7w Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
Resolution2.89 Å
Binding residue
(original residue number in PDB)
Y9 Y22 R52 R53 F54 N62 V65 H68 N69 I72 V73 R76
Binding residue
(residue number reindexed from 1)
Y9 Y23 R53 R54 F55 N63 V66 H69 N70 I73 V74 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4z7w, PDBe:4z7w, PDBj:4z7w
PDBsum4z7w
PubMed25948817
UniProtQ30069

[Back to BioLiP]