Structure of PDB 4z7v Chain A Binding Site BS01

Receptor Information

>4z7v Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRR
FRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLG
QPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISY
LTFLPSADEIYDCKVEHWGLDEPLLKHWEP

Ligand information

>4z7v Chain J (length=13) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SGEGSFQPSQENP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4z7v Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	Y9 W43 R52 R53 F54 N62 V65 H68 N69 I72 R76
Binding residue (residue number reindexed from 1)	Y8 W43 R52 R53 F54 N62 V65 H68 N69 I72 R76

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4z7v, PDBe:4z7v, PDBj:4z7v
PDBsum	4z7v
PubMed	25948817
UniProt	Q30069

[Back to BioLiP]