Structure of PDB 4z7u Chain A Binding Site BS01

Receptor Information
>4z7u Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLF
RRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVT
LGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKI
SYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Ligand information
>4z7u Chain J (length=16) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APSGEGSFQPSQENPQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z7u Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y9 W43 R52 R53 F54 N62 V65 H68 N69 R76
Binding residue
(residue number reindexed from 1)		Y10 W45 R54 R55 F56 N64 V67 H70 N71 R78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4z7u, PDBe:4z7u, PDBj:4z7u
PDBsum4z7u
PubMed25948817
UniProtQ30069

[Back to BioLiP]