Structure of PDB 4z7l Chain A Binding Site BS01

Receptor Information
>4z7l Chain A (length=218) Species: 402880 (Methanococcus maripaludis C5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDLEYMHISYPNILLNMRDGSKLRGYFAKKYIDEEIVHNHRDNAFVYKYP
QIQFKIIDRSPLIIGIGSLGINFLESKRIFFEKELIISNDTNDITEVNVH
KDMDHFGTTDKILKYQFKTPWMALNAKNSEIYKNSDEIDREEFLKRVLIG
NILSMSKSLGYTIEEKLKVKINLKEVPVKFKNQNMVGFRGEFYINFDIPQ
YLGIGRNVSRGFGTVVKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z7l A Non-Stem-Loop CRISPR RNA Is Processed by Dual Binding Cas6.
Resolution3.503 Å
Binding residue
(original residue number in PDB)		R24 H38 N39 F45 V46 Y47 K127 N128 I149 G150 N151 L153 S154 K157 T162 I163 K166 L167 K181 Q183 G205 R206 N207 S209
Binding residue
(residue number reindexed from 1)		R24 H38 N39 F45 V46 Y47 K127 N128 I149 G150 N151 L153 S154 K157 T162 I163 K166 L167 K181 Q183 G205 R206 N207 S209
Binding affinityPDBbind-CN: Kd=0.013uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042802 identical protein binding

View graph for
Molecular Function
External links
PDB RCSB:4z7l, PDBe:4z7l, PDBj:4z7l
PDBsum4z7l
PubMed26996962
UniProtA4FXZ3

[Back to BioLiP]