Structure of PDB 4z68 Chain A Binding Site BS01

Receptor Information
>4z68 Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRV
SVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVAD
LWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDI
QDLLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z68 Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.
Resolution1.859 Å
Binding residue
(original residue number in PDB)
R525 S527 F532 G535 Y536 N537 L560 N565 Y569 H571 D589 W591 F593 E598 K602
Binding residue
(residue number reindexed from 1)
R36 S38 F43 G46 Y47 N48 L71 N76 Y80 H82 D100 W102 F104 E109 K113
Enzymatic activity
Enzyme Commision number 2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.
External links
PDB RCSB:4z68, PDBe:4z68, PDBj:4z68
PDBsum4z68
PubMed26774128
UniProtQ9H2K2|TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 (Gene Name=TNKS2)

[Back to BioLiP]