Structure of PDB 4z0y Chain A Binding Site BS01

Receptor Information

>4z0y Chain A (length=347) Species: 13449 (Coreopsis grandiflora) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APITAPDITSICKDASSGIGNQEGAIRTRKCCPPSLGKKIKDFQFPNDKK
VRMRWPAHKGTKKQVDDYRRAIAAMRALPDDDPRSFVSQAKIHCAYCNGG
YTQVDSGFPDIDIQIHNSWLFFPFHRWYLYFYERILGSLIDEPNFALPYW
KWDEPKGMPISNIFLGDASNPLYDQYRDANHIEDRIVDLDYDGKDKDIPD
QQQVACNLSTVYRDLVRNGVDPTSFFGGKYVAGDSPVANGDPSVGSVEAG
SHTAVHRWVGDPTQPNNEDMGNFYSAGYDPVFYIHHANVDRMWKLWKELR
LPGHVDITDPDWLNASYVFYDENKDLVRVYNKDCVNLDKLKYNFIEN

Ligand information

>4z0y Chain E (length=8) Species: 13449 (Coreopsis grandiflora) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VFTTPCDP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4z0y Aurone synthase is a catechol oxidase with hydroxylase activity and provides insights into the mechanism of plant polyphenol oxidases.
Resolution	1.6 Å
Binding residue (original residue number in PDB)	D190 Q202 A205 C206 R217
Binding residue (residue number reindexed from 1)	D190 Q202 A205 C206 R217

Enzymatic activity

Catalytic site (original residue number in PDB)	H93 H116 H125 H252 H256 F273 H286
Catalytic site (residue number reindexed from 1)	H93 H116 H125 H252 H256 F273 H286
Enzyme Commision number	?

Gene Ontology

	Molecular Function
GO:0004097	catechol oxidase activity
GO:0016491	oxidoreductase activity

View graph for
Molecular Function

External links

PDB	RCSB:4z0y, PDBe:4z0y, PDBj:4z0y
PDBsum	4z0y
PubMed	26976571
UniProt	A0A075DN54

[Back to BioLiP]