Structure of PDB 4z0x Chain A Binding Site BS01

Receptor Information
>4z0x Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVLTQPPSVSVAPGQTASITCSGDKLGDKYVSWYQQRPGQSPVLVLYQDS
KRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSALVFGGGT
KLTVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z0x Affinity maturation of a broadly neutralizing human monoclonal antibody that prevents acute hepatitis C virus infection in mice.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D29 K30 Y31 D50 W90 S93
Binding residue
(residue number reindexed from 1)		D28 K29 Y30 D49 W89 S92
External links