Structure of PDB 4z0u Chain A Binding Site BS01

Receptor Information

>4z0u Chain A (length=155) Species: 331111 (Escherichia coli O139:H28 str. E24377A)

MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELM
AAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKN
VDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTG
YQVEV

Ligand information

>4z0u Chain D (length=4) Species: 562 (Escherichia coli)

DIPF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4z0u Interaction with Single-stranded DNA-binding Protein Stimulates Escherichia coli Ribonuclease HI Enzymatic Activity.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): K3 L26 Y28 L59 K60 C63
• Binding residue (residue number reindexed from 1): K3 L26 Y28 L59 K60 C63

Enzymatic activity

• Catalytic site (original residue number in PDB): D10 G11 E48 D70 H124 D134
• Catalytic site (residue number reindexed from 1): D10 G11 E48 D70 H124 D134
• Enzyme Commision number: 3.1.26.4: ribonuclease H.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004523 RNA-DNA hybrid ribonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006401 RNA catabolic process
• GO:0043137 DNA replication, removal of RNA primer

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4z0u, PDBe:4z0u, PDBj:4z0u
• PDBsum: 4z0u
• PubMed: 25903123
• UniProt: A7ZHV1|RNH_ECO24 Ribonuclease H (Gene Name=rnhA)