Structure of PDB 4yz6 Chain A Binding Site BS01

Receptor Information
>4yz6 Chain A (length=175) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWG
DGYYKGETNTAEQEHRKRVIRELNSLISEEVTDTEWFFLVSMTQSFVNGV
GLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVV
ELGSSEVISQSSDLMHKVNNLFNFN
Ligand information
>4yz6 Chain B (length=18) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPIARRASLHRFLEKRKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yz6 Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Q53 W92 D94 Y96 N126 I129 E143 V144 F151 T156
Binding residue
(residue number reindexed from 1)		Q10 W49 D51 Y53 N74 I77 E80 V81 F88 T93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4yz6, PDBe:4yz6, PDBj:4yz6
PDBsum4yz6
PubMed26258305
UniProtQ9FIP9|MYC3_ARATH Transcription factor MYC3 (Gene Name=MYC3)

[Back to BioLiP]