Structure of PDB 4yyj Chain A Binding Site BS01

Receptor Information
>4yyj Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMK
DKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMM
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yyj A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
F44 F45 V49 Y99 N100 Y106
Binding residue
(residue number reindexed from 1)
F23 F24 V28 Y78 N79 Y85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4yyj, PDBe:4yyj, PDBj:4yyj
PDBsum4yyj
PubMed26365797
UniProtQ9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 (Gene Name=BRD9)

[Back to BioLiP]