Structure of PDB 4yyi Chain A Binding Site BS01

Receptor Information
>4yyi Chain A (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKD
KIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yyi A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
V49 P55 Y99 N100 Y106
Binding residue
(residue number reindexed from 1)
V27 P33 Y77 N78 Y84
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4yyi, PDBe:4yyi, PDBj:4yyi
PDBsum4yyi
PubMed26365797
UniProtQ9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 (Gene Name=BRD9)

[Back to BioLiP]