Structure of PDB 4yy6 Chain A Binding Site BS01

Receptor Information
>4yy6 Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMK
DKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMM
SK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yy6 A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
Resolution1.45 Å
Binding residue
(original residue number in PDB)
H42 F44 F45 V49 I53 P55 Y99 N100 V105 Y106
Binding residue
(residue number reindexed from 1)
H21 F23 F24 V28 I32 P34 Y78 N79 V84 Y85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4yy6, PDBe:4yy6, PDBj:4yy6
PDBsum4yy6
PubMed26365797
UniProtQ9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 (Gene Name=BRD9)

[Back to BioLiP]