Structure of PDB 4ywc Chain A Binding Site BS01

Receptor Information
>4ywc Chain A (length=179) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAAAPQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVIL
GWGDGYYKGENTAEQEHRKRVIRELNSLISGNDEEVTDTEWFFLVSMTQS
FVNGVGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIAT
QNGVVELGSSEVISQSSDLMHKVNNLFNF
Ligand information
>4ywc Chain C (length=22) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVPQARKASLARFLEKRKERLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ywc Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S18 W92 D94 Y96 I129 E148 L152 M155
Binding residue
(residue number reindexed from 1)		S1 W52 D54 Y56 I79 E90 L94 M97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ywc, PDBe:4ywc, PDBj:4ywc
PDBsum4ywc
PubMed26258305
UniProtQ9FIP9|MYC3_ARATH Transcription factor MYC3 (Gene Name=MYC3)

[Back to BioLiP]