Structure of PDB 4ysi Chain A Binding Site BS01

Receptor Information
>4ysi Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYQKSVGF
FLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGF
SNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ysi Structure of USP7 with a novel viral protein
Resolution1.02 Å
Binding residue
(original residue number in PDB)
M100 F118 R152 E162 D164 W165 G166 F167 S168 N169
Binding residue
(residue number reindexed from 1)
M38 F51 R85 E95 D97 W98 G99 F100 S101 N102
Enzymatic activity
Enzyme Commision number 3.4.19.12: ubiquitinyl hydrolase 1.
External links
PDB RCSB:4ysi, PDBe:4ysi, PDBj:4ysi
PDBsum4ysi
PubMed26786098
UniProtQ93009|UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 (Gene Name=USP7)

[Back to BioLiP]