Structure of PDB 4yoz Chain A Binding Site BS01

Receptor Information

>4yoz Chain A (length=342) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETF
CQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDM
SVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIE
VVIRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTC
EEVIFPNRPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTC
FEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQ
ANSHVYRSVLLKERGDLIKFYNTIYVGRVKSFALKYPLSPFP

Ligand information

>4yoz Chain B (length=9) Species: 10566 (Human papillomavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DLYCYEQLN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4yoz Structural mechanisms of DREAM complex assembly and regulation.
Resolution	2.245 Å
Binding residue (original residue number in PDB)	K853 T860 F861 Q862 D929 I931 Y934 N935
Binding residue (residue number reindexed from 1)	K280 T287 F288 Q289 D316 I318 Y321 N322

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006357	regulation of transcription by RNA polymerase II
GO:0051726	regulation of cell cycle

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4yoz, PDBe:4yoz, PDBj:4yoz
PDBsum	4yoz
PubMed	25917549
UniProt	P28749\|RBL1_HUMAN Retinoblastoma-like protein 1 (Gene Name=RBL1)

[Back to BioLiP]