Structure of PDB 4yo2 Chain A Binding Site BS01

Receptor Information

>4yo2 Chain A (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QPSRKEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYD
IVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEENKYAEQIMMI
KKKNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHVEDLDK
SKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKP

Ligand information

>4yo2 Chain C (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttcccgccaaaaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4yo2 Structural insights into the DNA-binding specificity of E2F family transcription factors.
Resolution	3.073 Å
Binding residue (original residue number in PDB)	R113 K116 S117 L118 E153 R156 R313 Y316 V333
Binding residue (residue number reindexed from 1)	R4 K7 S8 L9 E44 R47 R158 Y161 V178

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

	Cellular Component
GO:0005667	transcription regulator complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4yo2, PDBe:4yo2, PDBj:4yo2
PDBsum	4yo2
PubMed	26632596
UniProt	A0AVK6\|E2F8_HUMAN Transcription factor E2F8 (Gene Name=E2F8)

[Back to BioLiP]