Structure of PDB 4yl6 Chain A Binding Site BS01

Receptor Information
>4yl6 Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQ
LYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yl6 Structural Insights into the Molecular Recognition between Cerebral Cavernous Malformation 2 and Mitogen-Activated Protein Kinase Kinase Kinase 3
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L299 M303 R307 S312 I315 Q316 F318 A319 L322 H323 Y325 R326 F356
Binding residue
(residue number reindexed from 1)		L9 M13 R17 S22 I25 Q26 F28 A29 L32 H33 Y35 R36 F66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4yl6, PDBe:4yl6, PDBj:4yl6
PDBsum4yl6
PubMed25982527
UniProtQ9BSQ5|CCM2_HUMAN Cerebral cavernous malformations 2 protein (Gene Name=CCM2)

[Back to BioLiP]