Structure of PDB 4yj0 Chain A Binding Site BS01

Receptor Information
>4yj0 Chain A (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQV
ALRRQQAQEEEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yj0 An ancient protein-DNA interaction underlying metazoan sex determination.
Resolution3.814 Å
Binding residue
(original residue number in PDB)		P74 K75 A77 I108 Q112 R123
Binding residue
(residue number reindexed from 1)		P5 K6 A8 I39 Q43 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yj0, PDBe:4yj0, PDBj:4yj0
PDBsum4yj0
PubMed26005864
UniProtQ9Y5R6|DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 (Gene Name=DMRT1)

[Back to BioLiP]