Structure of PDB 4yh8 Chain A Binding Site BS01

Receptor Information

>4yh8 Chain A (length=180) Species: 284812 (Schizosaccharomyces pombe 972h-)

KVNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNMYKNPIHEPNGKKF
TQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGDHLVGNVYVRFKYE
ESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQHETSECQRGGLCN
FMHAKKPSPQLLRDLVLAQRKYLALNAAEE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 4yh8 Chain A Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4yh8 A novel 3' splice site recognition by the two zinc fingers in the U2AF small subunit.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): C18 C27 C33 H37
• Binding residue (residue number reindexed from 1): C4 C13 C19 H23
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030628 pre-mRNA 3'-splice site binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000389 mRNA 3'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0071004 U2-type prespliceosome
• GO:0089701 U2AF complex

External links

• PDB: RCSB:4yh8, PDBe:4yh8, PDBj:4yh8
• PDBsum: 4yh8
• PubMed: 26215567
• UniProt: Q09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)