Structure of PDB 4ygy Chain A Binding Site BS01

Receptor Information

>4ygy Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQ
VYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARL
FRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWF
DNMSDTELHDLLPFFEQLSRVDDVYSVLR

Ligand information

>4ygy Chain C (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SPTG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ygy Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
Resolution	2.36 Å
Binding residue (original residue number in PDB)	N96 D98 T152 A153 S154 L155 R178
Binding residue (residue number reindexed from 1)	N20 D22 T76 A77 S78 L79 R102

Enzymatic activity

Enzyme Commision number

3.1.3.16: protein-serine/threonine phosphatase.

Gene Ontology

	Molecular Function
GO:0016791	phosphatase activity

View graph for
Molecular Function

External links

PDB	RCSB:4ygy, PDBe:4ygy, PDBj:4ygy
PDBsum	4ygy
PubMed	26332362
UniProt	Q9GZU7\|CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (Gene Name=CTDSP1)

[Back to BioLiP]