Structure of PDB 4yfh Chain A Binding Site BS01

Receptor Information
>4yfh Chain A (length=74) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKKGDALQLVGFGTF
KVNHRAEANVPAFVSGKALKDAVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yfh HU multimerization shift controls nucleoid compaction.
Resolution3.49 Å
Binding residue
(original residue number in PDB)		Q43 G82 K83
Binding residue
(residue number reindexed from 1)		Q43 G66 K67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
Biological Process
GO:0006270 DNA replication initiation
GO:0006281 DNA repair
GO:0006351 DNA-templated transcription
GO:0006974 DNA damage response
GO:0030261 chromosome condensation
GO:0036386 bacterial nucleoid packaging
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0016020 membrane
GO:1990103 DnaA-HU complex
GO:1990178 HU-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yfh, PDBe:4yfh, PDBj:4yfh
PDBsum4yfh
PubMed27482541
UniProtP0ACF0|DBHA_ECOLI DNA-binding protein HU-alpha (Gene Name=hupA)

[Back to BioLiP]