Structure of PDB 4ydv Chain A Binding Site BS01

Receptor Information
>4ydv Chain A (length=206) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVLAQSPDSLAVSPGERATIHCKSSQHSIAWYQQRPGQPPKLLLYWASMR
LSGVPDRFSGSGSGTDFTLTINNLQAEDVAIYYCHQYSSHPPTFGHGTRV
ELRRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFN
Ligand information
>4ydv Chain Q (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WGCSGKLICTT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ydv Human Non-neutralizing HIV-1 Envelope Monoclonal Antibodies Limit the Number of Founder Viruses during SHIV Mucosal Infection in Rhesus Macaques.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		W50 M53
Binding residue
(residue number reindexed from 1)		W46 M49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
GO:0016064 immunoglobulin mediated immune response
GO:0050853 B cell receptor signaling pathway
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005886 plasma membrane
GO:0019814 immunoglobulin complex
GO:0070062 extracellular exosome
GO:0071735 IgG immunoglobulin complex
GO:0071738 IgD immunoglobulin complex
GO:0071742 IgE immunoglobulin complex
GO:0071745 IgA immunoglobulin complex
GO:0071753 IgM immunoglobulin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ydv, PDBe:4ydv, PDBj:4ydv
PDBsum4ydv
PubMed26237403
UniProtP01834|IGKC_HUMAN Immunoglobulin kappa constant (Gene Name=IGKC)

[Back to BioLiP]